PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_15746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 339aa    MW: 38780.6 Da    PI: 7.1013
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_15746.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-5471361129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                   +ppGfrFhPtdeelv++yL+kkv+ k+++l ++ik+vd+yk+ePwdL++  k+ + ++++w+fFs++dkky+tg+r+nrat++g+Wkatg+dk++++
  MLOC_15746.1   7 VPPGFRFHPTDEELVDYYLRKKVQLKRIDL-DIIKDVDLYKIEPWDLQErcKIGTeDQNDWFFFSHKDKKYPTGTRTNRATTAGFWKATGRDKPIYV 102
                   69****************************.99**************953444442455************************************** PP

           NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    k+ lvg++ktLvfykgrap+g+k dW+mheyrle
  MLOC_15746.1 103 -KHCLVGMRKTLVFYKGRAPNGQKLDWIMHEYRLE 136
                   .899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-595156IPR003441NAC domain
PROSITE profilePS5100557.5867156IPR003441NAC domain
PfamPF023659.9E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MNAFSHVPPG FRFHPTDEEL VDYYLRKKVQ LKRIDLDIIK DVDLYKIEPW DLQERCKIGT  60
EDQNDWFFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YVKHCLVGMR KTLVFYKGRA  120
PNGQKLDWIM HEYRLETNEN GAPHDEGWVV CKVFKKRVAT VQRMATTDSP FWFNHEHVAF  180
MAPHIDSPRQ AVHHLQNAAY HHGHHQTYHH PCKVELEYHH LLPQEPASFL QLPQLEIPRL  240
PDLIGAVAAS LQPCNQTHDG QASRQLEIEP IYVTDASAGE WRDLDKFMAS QLSHGGATPK  300
ESSGYANPAL AFQAEGNREE ALDYVSASAS SGGDNGLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-48615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934230.0JQ693423.1 Brachypodium distachyon SWN2 (SWN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266823.10.0uncharacterized protein LOC100845863
RefseqXP_010239582.10.0PREDICTED: uncharacterized protein LOC100845863 isoform X1
SwissprotQ9FWX21e-121NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM0UYR10.0M0UYR1_HORVD; Uncharacterized protein
STRINGMLOC_15746.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-112NAC 007